PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.9G419000.1.p
Common NameLOC101781076, SETIT_036390mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family G2-like
Protein Properties Length: 352aa    MW: 38942 Da    PI: 7.2981
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.9G419000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like110.11.1e-3447101155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kprl+WtpeLHerFv+av+qLGG++kAtPkti++lm+v+gLtl+h+kSHLQkYRl
  Seita.9G419000.1.p  47 KPRLKWTPELHERFVDAVNQLGGPDKATPKTIMRLMGVPGLTLYHLKSHLQKYRL 101
                         79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.95644104IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.6E-3345102IPR009057Homeodomain-like
SuperFamilySSF466894.66E-1846102IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-2447102IPR006447Myb domain, plants
PfamPF002491.6E-1049100IPR001005SANT/Myb domain
PfamPF143793.2E-25149195IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MYHHQQQLQS HSHFLSSRQT SPPERHLLLQ GGSIPAEPGL VLSTDAKPRL KWTPELHERF  60
VDAVNQLGGP DKATPKTIMR LMGVPGLTLY HLKSHLQKYR LSKNVHAQAN GGNAKNMVGC  120
TMAMEKPPEG NSSPASHINL GTQTNKSVHI GEALQMQIEV QRRLHEQLEV QRHLQLRIEA  180
QGKYLQSVLE KAQETLAKQN AGSVGLETAK MQLSELVSKV STECLQHAFT GFEEMEGSQM  240
AQGHTMQLGD GSVDSCLTAC DGSQKDQDIL SISLSAHRGK EIAGMAFDIQ AKERGSEDLF  300
LDKLSRTPPS HQERRERDSF IMAAKLDLNI NDTNDGPQNC KKFDLNGFNW T*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00331DAPTransfer from AT3G04030Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9437120.0EU943712.1 Zea mays clone 1680873 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004984520.10.0PREDICTED: uncharacterized protein LOC101781076
SwissprotQ9SAK52e-58APL_ARATH; Myb family transcription factor APL
TrEMBLK4ABY30.0K4ABY3_SETIT; Uncharacterized protein
STRINGSi036390m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35743879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.31e-106G2-like family protein